Protein coding transcript 18297

• Transcript: Ll_transcript_392568
• CDS coordinates: 1624-2328 (+)
• Peptide sequence: MAKDAIALLDHLGWKKAHVFGHSMGAMIACKVAAMVPDRVLSLALLNVTGGGFECFPKLDRQTVSVAYRFLKAKTPEQRAAVDLDTHYSQEYLEEYVGTDKRRTILYQQYVKGISASGMQSNYGFEGQLNACWTHKISQTEIEVIQSAGFLISVIHGRHDIIAQIYYAKKFAERLQPMARMVNLHGGHLVSHERPEEVNQALFDLIKASEVKMSPHEWTNLPTKQSSWWLVNVW*
• ORF Type: complete

Annotations of Ll_transcript_392568

• Blastp: Putative aminoacrylate hydrolase RutD from Methylobacterium with 26.05% of identity
• Blastx: Putative aminoacrylate hydrolase RutD from Methylobacterium with 25.86% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Mchl_2054)
• CantataDB: Link to cantataDB annotations (CNT0001750)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434641.1)
• Pfam: alpha/beta hydrolase fold (PF00561.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;