Protein coding transcript 182980

• Transcript: Ll_transcript_16754
• CDS coordinates: 82-591 (+)
• Peptide sequence: MEKQKPEPQPWRPDPFHPTTVFRPPETPWDPMEFLSRSWSASAFEVSKALTPAQLPPQPSKPIINNNGGGYGGRGGGGGGGGGVIIEEIAGEVEESSSSSLAAVSGNPFSFASSETSQMVMDRIMSQSQEVTSPRTSGRLSHSSGPLNGSLTDSPPLSPSEVDDFKLSL*
• ORF Type: complete

Annotations of Ll_transcript_16754

• Blastp: VAN3-binding protein from Arabidopsis with 45.45% of identity
• Blastx: VAN3-binding protein from Arabidopsis with 67.74% of identity
• Eggnog: Plant pleckstrin homology-like region(ENOG4111DWT)
• Kegg: Link to kegg annotations (AT3G63300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432524.1)
• Pfam: Auxin canalisation (PF05703.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;