Protein coding transcript 182981

• Transcript: Ll_transcript_16762
• CDS coordinates: 1172-2047 (+)
• Peptide sequence: MSIFYVCLQYTRCNNHHNNVINNSLSSQYRTAVNGGAAAGGGSKTVGRWLKDRREKKKEETRAHNAQLHAAISVAGVAAAVAAIAAATAASSSSGKDEQRAKTDMAVASAATLVAAQCVEAAEAMGAERDHLASVVSSAVNVRSASDITTLTAAAATALRGAATLKARALKEVWNIAAVIPVEKNLVAGGGNGTGSNGSSSSSFSGELAPEENFLGICSRELLARGCELLKRTRTGELHWKIVSVYINRTNQVMLKMKSRHVAGTITKKKKNVVLGVIKDMPAWPGRHLLEG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_16762

• Blastp: VAN3-binding protein from Arabidopsis with 63.23% of identity
• Blastx: VAN3-binding protein from Arabidopsis with 70.28% of identity
• Eggnog: Plant pleckstrin homology-like region(ENOG4111DWT)
• Kegg: Link to kegg annotations (AT3G63300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432524.1)
• Pfam: Auxin canalisation (PF05703.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;