Transcript | Ll_transcript_16763 |
---|---|
CDS coordinates | 82-1041 (+) |
Peptide sequence | MEKQKPEPQPWRPDPFHPTTVFRPPETPWDPMEFLSRSWSASAFEVSKALTPAQLPPQPSKPIINNNGGGYGGRGGGGGGGGGVIIEEIAGEVEESSSSSLAAVSGNPFSFASSETSQMVMDRIMSQSQEVTSPRTSGRLSHSSGPLNGSLTDSPPLSPSEVDDFKYTRCNNHHNNVINNSLSSQYRTAVNGGAAAGGGSKTVGRWLKDRREKKKEETRAHNAQLHAAISVAGVAAAVAAIAAATAASSSSGKDEQRAKTDMAVASAATLVAAQCVEAAEAMGAERDHLASVVSSAVNVRSASDITTLTAAAATGIYMI* |
ORF Type | complete |
Blastp | VAN3-binding protein from Arabidopsis with 52.52% of identity |
---|---|
Blastx | VAN3-binding protein from Arabidopsis with 47.63% of identity |
Eggnog | Plant pleckstrin homology-like region(ENOG4111DWT) |
Kegg | Link to kegg annotations (AT3G63300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432524.1) |
Pfam | Auxin canalisation (PF05703.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer