Protein coding transcript 182994

• Transcript: Ll_transcript_18441
• CDS coordinates: 926-1552 (+)
• Peptide sequence: MAIISLCFIAQTYQHASAVIQSLVEEDINPKFLVQLDKLIHLLETPIFAYLRLQLLEPGRYIWLFKALYGLLMLLPQQSAAFKILKTRLKAVPSYSFNGMQSKRMPSGDSYQFLHHMSNGSQIIEDDDLTKDGGSSHNGINFDARLQQFQQMQHLHRMHFKAQTKSLNNSTPLPKEAQREEEPSRTQSIDLNVLPHRSSKRGPGQLKL*
• ORF Type: complete

Annotations of Ll_transcript_18441

• Blastp: Protein VAC14 homolog from Arabidopsis with 55.36% of identity
• Blastx: Protein VAC14 homolog from Arabidopsis with 57.09% of identity
• Eggnog: vac14 homolog (S. cerevisiae)(ENOG410XP6E)
• Kegg: Link to kegg annotations (AT2G01690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420378.1)
• Pfam: Vacuolar protein 14 C-terminal Fig4p binding (PF11916.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;