Transcript | Ll_transcript_17422 |
---|---|
CDS coordinates | 1-366 (+) |
Peptide sequence | SKPYVELPILDISQPFQPSSLSLLSKACKKWGFFHIINHGISKDLCSRLYSLSKELFSLPSDTKLKLGPLSSIKSYTPHFIASPFFESLRVDGPNFYFSAKCSEDILFDKQNSKFRYCISTL |
ORF Type | internal |
Blastp | Gibberellin 20-oxidase-like protein from Arabidopsis with 50% of identity |
---|---|
Blastx | Gibberellin 20-oxidase-like protein from Arabidopsis with 50% of identity |
Eggnog | 2OGFe(II) oxygenase(COG3491) |
Kegg | Link to kegg annotations (AT5G51310) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459798.1) |
Pfam | non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer