Protein coding transcript 183059

• Transcript: Ll_transcript_17445
• CDS coordinates: 96-674 (+)
• Peptide sequence: MADLSEKIIKLVLMSLGDGLDKLFYDSEFNKCHGYLRINSYSAPEQSFEDQVEGLGMHTDMSCITVLYQDEIGGLQVRSHDGKWIDINPSEGTLVVNIGDMLQAWSNDKLRSSEHRVVLKQHVNRFSFAFFWCFEDEKVILAPDEVVGEENKRVYNSFVCLDYLKFRENNQIGKFEKVGFTVRDFAGTKSQL*
• ORF Type: complete

Annotations of Ll_transcript_17445

• Blastp: Gibberellin 20-oxidase-like protein from Arabidopsis with 58.79% of identity
• Blastx: Gibberellin 20-oxidase-like protein from Arabidopsis with 57.62% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT5G51310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459798.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;