Protein coding transcript 183096

• Transcript: Ll_transcript_18639
• CDS coordinates: 37-537 (+)
• Peptide sequence: MMCLVSPRTGRHLQRYDNGCRQVVGCIPYRYKSNGTQDKEIEVLVISAQKGQGMQFPKGGWEIDESMEQAALRETIEEAGVVGSIESKLGKWLYKSKRQDSVHEGYMFSLLVKKQLENWPEKNIRNRRWMSVAEAKEVCPYTWMKEALDVLVSRQNLNPSQKGERY*
• ORF Type: complete

Annotations of Ll_transcript_18639

• Blastp: Nudix hydrolase 4 from Arabidopsis with 62.11% of identity
• Blastx: Nudix hydrolase 4 from Arabidopsis with 61.59% of identity
• Eggnog: nudix (nucleoside diphosphate linked moiety X)-type motif(ENOG4111I7R)
• Kegg: Link to kegg annotations (AT1G18300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432641.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;