Protein coding transcript 183097

• Transcript: Ll_transcript_18643
• CDS coordinates: 3-407 (+)
• Peptide sequence: YRYKSNGSQDKEIEVLVISAQKGQGMQFPKGGWEIDESMEQAALRETVEEAGVVGKVESKLGKWFYKSKSQAIMHEGYMFPLLVKKQLDNWPEMNFRKRRWMTVAEAKEICPHSWMHEALDVLVSRQSQPQPKL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_18643

• Blastp: Nudix hydrolase 21, chloroplastic from Arabidopsis with 59.85% of identity
• Blastx: Nudix hydrolase 21, chloroplastic from Arabidopsis with 59.85% of identity
• Eggnog: nudix (nucleoside diphosphate linked moiety X)-type motif(ENOG4111I7R)
• Kegg: Link to kegg annotations (AT1G73540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457158.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;