Transcript | Ll_transcript_491593 |
---|---|
CDS coordinates | 57-686 (+) |
Peptide sequence | MSTNNNNEVAGEPTKTTFSLLETASAAIQNFAPVNKIHQHLCAFHFYSDDMTRQVEAHHFCGHQNEEMRQCLIYDSNETNAKLIGLEYIISDNLFFTLPDQEKPLWHSHEYEVKSGFYFLPGIPAPIEYSDLEKVCKTYGKVFHFWQVDKGHTLPLGLPQLMMALTKDGQINHDLVQSMINILFIAFFLYCYLYIDMHVVLMLLSMLLM* |
ORF Type | complete |
Blastp | Oil body-associated protein 1B from Arabidopsis with 68.18% of identity |
---|---|
Blastx | Oil body-associated protein 1B from Arabidopsis with 69.82% of identity |
Eggnog | DUF1264 domain protein(ENOG410XPKS) |
Kegg | Link to kegg annotations (AT2G31985) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415585.1) |
Pfam | Protein of unknown function (DUF1264) (PF06884.10) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer