Transcript | Ll_transcript_18646 |
---|---|
CDS coordinates | 133-663 (+) |
Peptide sequence | MGLFFSRNLPFKFCLPFIFSKKISGDFFPRQLEKMMCLVARTGRHLQRYDGGCRQVVGCIPYRYRLKGNQNKELEVLVISAQKGNGMQFPKGGWETDESMEQAALRETIEEAGVVGSIESKLGKWLYKSKRQDRLHEGYMFSLLVKKQLENWPEENIRKRRWVSVYLINLSIYLLI* |
ORF Type | complete |
Blastp | Nudix hydrolase 4 from Arabidopsis with 57.99% of identity |
---|---|
Blastx | Nudix hydrolase 4 from Arabidopsis with 57.99% of identity |
Eggnog | nudix (nucleoside diphosphate linked moiety X)-type motif(ENOG4111I7R) |
Kegg | Link to kegg annotations (AT1G18300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431656.1) |
Pfam | NUDIX domain (PF00293.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer