Protein coding transcript 1832

• Transcript: Ll_transcript_491594
• CDS coordinates: 57-773 (+)
• Peptide sequence: MSTNNNNEVAGEPTKTTFSLLETASAAIQNFAPVNKIHQHLCAFHFYSDDMTRQVEAHHFCGHQNEEMRQCLIYDSNETNAKLIGLEYIISDNLFFTLPDQEKPLWHSHEYEVKSGFYFLPGIPAPIEYSDLEKVCKTYGKVFHFWQVDKGHTLPLGLPQLMMALTKDGQINHDLVQSCAKRMGVDFEKERKEREYMTGPTHGVHPLANGGGKGLKTVLREVELKHDELPHSANRVFV*
• ORF Type: complete

Annotations of Ll_transcript_491594

• Blastp: Oil body-associated protein 1A from Arabidopsis with 64.29% of identity
• Blastx: Oil body-associated protein 1B from Arabidopsis with 66.09% of identity
• Eggnog: DUF1264 domain protein(ENOG410XPKS)
• Kegg: Link to kegg annotations (AT1G05510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415585.1)
• Pfam: Protein of unknown function (DUF1264) (PF06884.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;