Protein coding transcript 183212

• Transcript: Ll_transcript_16606
• CDS coordinates: 184-1188 (+)
• Peptide sequence: MSLLFNSHRFRSILYLSLSLSPIPKSQSYLHPSPFTLNFFSTASNHKAFTVPYLINKFGFSPEVALKTSNRVHFDNPQKPESVLAFFRTHGFSDTQINSVMRRAPELLTCDPINRVLPKFQFLISRGASPSDVVATVTRSPDFLRKSLENHIIPAFEVVRRFSPSDERAIACVIASPTAISDARVQHNVNMLIEEGVTHNNIYHLFRTRPTVLCSNDLGKVLDEVKKMGFDPSKTNFSVAMLAKKAITKAQWDAKIDAFKTWGWSEQEILEAFKRLPQFMLRSPDKLNAVISFWVGKLGWDPSTLLRAPVIFGYSLEKRLIPRASVVKELLSKGL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_16606

• Blastp: Transcription termination factor MTERF8, chloroplastic from Arabidopsis with 23.67% of identity
• Blastx: Transcription termination factor MTERF8, chloroplastic from Arabidopsis with 21.15% of identity
• Eggnog: mitochondrial transcription termination(ENOG410XT49)
• Kegg: Link to kegg annotations (AT5G54180)
• CantataDB: Link to cantataDB annotations (CNT0002230)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450960.1)
• Pfam: mTERF (PF02536.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;