| Transcript | Ll_transcript_17913 |
|---|---|
| CDS coordinates | 3-329 (-) |
| Peptide sequence | YRAALIQGASHEEAAMGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPPLSLSRLIKYTKGKEGKIAVVVGTITYDIRTYEF |
| ORF Type | internal |
| Blastp | 60S ribosomal protein L18 from Cicer with 85.56% of identity |
|---|---|
| Blastx | 60S ribosomal protein L18 from Cicer with 85.56% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019441162.1) |
| Pfam | Ribosomal protein 60S L18 and 50S L18e (PF17135.3) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer