Protein coding transcript 183289

• Transcript: Ll_transcript_19159
• CDS coordinates: 58-759 (+)
• Peptide sequence: MAAAHCNYLSTLPATNLKLCSDHSVRLSHTLTLKSPNSSWIGTKLCVGVKPHVWVCTRRPFSAIVSFSLPTANPERVSPSQELPKWSSKAIKSFAMGELEARKFKYPTTGTEAFLMGLLIEGTNLASKFLRAHGITLFKVRDETVKLLGKADMFFFSPEHPPLTEQAQRALDWAIDQKIKSDDGGEVTTAHILLGIWSEVDSPGHKILSTLGFNDEKAKELDSSISKSGIKDD*
• ORF Type: complete

Annotations of Ll_transcript_19159

• Blastp: ATP-dependent Clp protease ATP-binding subunit CLPT2, chloroplastic from Arabidopsis with 59.02% of identity
• Blastx: ATP-dependent Clp protease ATP-binding subunit CLPT2, chloroplastic from Arabidopsis with 59.91% of identity
• Eggnog: Clp amino terminal domain(ENOG410YNK7)
• Kegg: Link to kegg annotations (AT4G12060)
• CantataDB: Link to cantataDB annotations (CNT0000208)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424432.1)
• Pfam: Clp amino terminal domain, pathogenicity island component (PF02861.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;