Protein coding transcript 1833

• Transcript: Ll_transcript_491595
• CDS coordinates: 293-859 (+)
• Peptide sequence: MTRQVEAHHFCGHQNEEMRQCLIYDSNETNAKLIGLEYIISDNLFFTLPDQEKPLWHSHEYEVKSGFYFLPGIPAPIEYSDLEKVCKTYGKVFHFWQVDKGHTLPLGLPQLMMALTKDGQINHDLVQSCAKRMGVDFEKERKEREYMTGPTHGVHPLANGGGKGLKTVLREVELKHDELPHSANRVFV*
• ORF Type: complete

Annotations of Ll_transcript_491595

• Blastp: Oil body-associated protein 1B from Arabidopsis with 65.43% of identity
• Blastx: Oil body-associated protein 1B from Arabidopsis with 59.21% of identity
• Eggnog: DUF1264 domain protein(ENOG410XPKS)
• Kegg: Link to kegg annotations (AT2G31985)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415585.1)
• Pfam: Protein of unknown function (DUF1264) (PF06884.10)
• Rfam: -
• GO: -