Protein coding transcript 183322

• Transcript: Ll_transcript_18968
• CDS coordinates: 864-1190 (+)
• Peptide sequence: MQIVLVSFLQVGTHGIIIEFSDPDYNTRRNATYLPEVAADEGWTKIEAIDSLIRKAGYNGPISESLRKSIKLTKYQSTLYTMKFSEYISYVKETRGEPPSILGAKLHK*
• ORF Type: complete

Annotations of Ll_transcript_18968

• Blastp: Uncharacterized protein At2g38710 from Arabidopsis with 71.26% of identity
• Blastx: Uncharacterized protein At2g38710 from Arabidopsis with 71.26% of identity
• Eggnog: ammecr1 domain-containing protein(COG2078)
• Kegg: Link to kegg annotations (AT2G38710)
• CantataDB: Link to cantataDB annotations (CNT0002653)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441354.1)
• Pfam: AMMECR1 (PF01871.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;