Protein coding transcript 183323

• Transcript: Ll_transcript_18979
• CDS coordinates: 533-859 (+)
• Peptide sequence: MQILLVSFMQVGTHGIIIEFSDPDYNTKRSATYLPEVAAHEGWTKIEAIDSLVRKAGYNGPITESFRQGIQLTKYQSTLFTMQFSEYVSYVKEARGEAPSILGAKLHN*
• ORF Type: complete

Annotations of Ll_transcript_18979

• Blastp: Uncharacterized protein At2g38710 from Arabidopsis with 71.72% of identity
• Blastx: Uncharacterized protein At2g38710 from Arabidopsis with 71.72% of identity
• Eggnog: ammecr1 domain-containing protein(COG2078)
• Kegg: Link to kegg annotations (AT2G38710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427679.1)
• Pfam: AMMECR1 (PF01871.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;