Transcript | Ll_transcript_18039 |
---|---|
CDS coordinates | 313-951 (+) |
Peptide sequence | MGSEVTIHVTGFKKFGGVAENPTESIVNNLKGYVERRGLHAGVTLGTCTVLEVAGDCALQLSQTMESVISKTDDISNANVVWLHLGVNSGAQRFAIERQAANEATFLCPDELGWQPNQVPIVVEDGGISRKRETSLSVEAILKSLKKGAYDVMISEDAGRFVCNYVYYHSLRFAEEKGSKALFVHVPLFSRIDEETQMKFTASLLEAIASAC* |
ORF Type | complete |
Blastp | Pyrrolidone-carboxylate peptidase from Pyrococcus with 31.72% of identity |
---|---|
Blastx | Pyrrolidone-carboxylate peptidase from Thermococcus with 29.51% of identity |
Eggnog | Removes 5-oxoproline from various penultimate amino acid residues except L-proline (By similarity)(COG2039) |
Kegg | Link to kegg annotations (PF1299) |
CantataDB | Link to cantataDB annotations (CNT0001358) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423582.1) |
Pfam | Pyroglutamyl peptidase (PF01470.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer