Protein coding transcript 183367

• Transcript: Ll_transcript_18041
• CDS coordinates: 224-862 (+)
• Peptide sequence: MGSEVTIHVTGFKKFGGVAENPTESIVNNLKGYVERRGLHAGVTLGTCTVLEVAGDCALQLSQTMESVISKTDDISNANVVWLHLGVNSGAQRFAIERQAANEATFLCPDELGWQPNQVPIVVEDGGISRKRETSLSVEAILKSLKKGAYDVMISEDAGRFVCNYVYYHSLRFAEEKGSKALFVHVPLFSRIDEETQMKFTASLLEAIASAC*
• ORF Type: complete

Annotations of Ll_transcript_18041

• Blastp: Pyrrolidone-carboxylate peptidase from Pyrococcus with 31.72% of identity
• Blastx: Pyrrolidone-carboxylate peptidase from Thermococcus with 29.51% of identity
• Eggnog: Removes 5-oxoproline from various penultimate amino acid residues except L-proline (By similarity)(COG2039)
• Kegg: Link to kegg annotations (PF1299)
• CantataDB: Link to cantataDB annotations (CNT0001358)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423582.1)
• Pfam: Pyroglutamyl peptidase (PF01470.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;