Protein coding transcript 183376

• Transcript: Ll_transcript_18062
• CDS coordinates: 314-1018 (+)
• Peptide sequence: MATQISQHLEPWHNLNGKVVMVTGASSGLGTEFCLNLARAGCRIIAAARRIDRLKSLCQEINRTTTFNDVSAGSLRAVAVELDGPTINKCLQKAWDAFGHIDVLINNAGVRGSVKSSLELSEEEWNHMLRTNLTGRWFVSKYVSIRMRDAQQKGTIINISSIDGLNRVNSHGAAAYASSKAGVIMLTKSSVFRSKGKMMNLNQTATAFPAHLPILNGKNWNRWSAQMRVIFGYQ*
• ORF Type: complete

Annotations of Ll_transcript_18062

• Blastp: 3-oxoacyl-[acyl-carrier-protein] reductase FabG from Vibrio with 34.34% of identity
• Blastx: 3-oxoacyl-[acyl-carrier-protein] reductase FabG from Thermotoga with 32.31% of identity
• Eggnog: )-reductase(ENOG410XNW1)
• Kegg: Link to kegg annotations (VC2021)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427170.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;