Protein coding transcript 183377

• Transcript: Ll_transcript_18063
• CDS coordinates: 314-931 (+)
• Peptide sequence: MATQISQHLEPWHNLNGKVVMVTGASSGLGTEFCLNLARAGCRIIAAARRIDRLKSLCQEINRTTTFNDVSAGSLRAVAVELDGPTINKCLQKAWDAFGHIDVLINNAGVRGSVKSSLELSEEEWNHMLRTNLTGRWFVSKYVSIRMRDAQQKGTIINISSIDGLNRVNSHGAAAYASSKAGVIMLTKIMALELGKHKISVNSISL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_18063

• Blastp: 3-oxoacyl-[acyl-carrier-protein] reductase FabG from Vibrio with 35.38% of identity
• Blastx: 3-oxoacyl-[acyl-carrier-protein] reductase FabG from Vibrio with 35.23% of identity
• Eggnog: )-reductase(ENOG410XNW1)
• Kegg: Link to kegg annotations (VC2021)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020228750.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;