Protein coding transcript 183378

• Transcript: Ll_transcript_18067
• CDS coordinates: 314-757 (+)
• Peptide sequence: MATQISQHLEPWHNLNGKVVMVTGASSGLGTEFCLNLARAGCRIIAAARRIDRLKSLCQEINRTTTFNDVSAGSLRAVAVELDGPTINKCLQKAWDAFGHIDVLINNAGVRDFKTERRMPAHQQKEEVSNRPWNCLRRNGITCSEPI*
• ORF Type: complete

Annotations of Ll_transcript_18067

• Blastp: Uncharacterized oxidoreductase SSP1627 from Staphylococcus with 36.36% of identity
• Blastx: 3-oxoacyl-[acyl-carrier-protein] reductase FabG from Aquifex with 39.06% of identity
• Eggnog: serine 3-dehydrogenase activity(COG4221)
• Kegg: Link to kegg annotations (SSP1627)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427170.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;