Transcript | Ll_transcript_18069 |
---|---|
CDS coordinates | 314-1000 (+) |
Peptide sequence | MATQISQHLEPWHNLNGKVVMVTGASSGLGTEFCLNLARAGCRIIAAARRIDRLKSLCQEINRTTTFNDVSAGSLRAVAVELDGPTINKCLQKAWDAFGHIDVLINNAGVRGSVKSSLELSEEEWNHMLRTNLTGRWFVSKYVSIRMRDAQQKGTIINISSIDGLNRVNSHGAAAYASSKAGVIMLTKEMAAKSYSNYGIKRFGLHAFSYIVWKTSRARNRTGSFNNA* |
ORF Type | complete |
Blastp | Uncharacterized oxidoreductase SSP1627 from Staphylococcus with 34.83% of identity |
---|---|
Blastx | 3-oxoacyl-[acyl-carrier-protein] reductase FabG from Vibrio with 36.31% of identity |
Eggnog | serine 3-dehydrogenase activity(COG4221) |
Kegg | Link to kegg annotations (SSP1627) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020228750.1) |
Pfam | short chain dehydrogenase (PF00106.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer