Protein coding transcript 183439

• Transcript: Ll_transcript_16738
• CDS coordinates: 546-1058 (+)
• Peptide sequence: MATSCSYMVSTKLSMLCNWAGGKRELVRNKRAFFISAQQQTDIKEADNVQEQVESSEKVKPKGTPLRPVEPQLNVKSKNMGREYGGQWLSSATRHVRIYAAYIDPETCEFDQTQMDKLTLILDPTNEFVWNSETCNQVYSYFQELVDHYEVLSLNKLLNTQLLYLGLKYG*
• ORF Type: complete

Annotations of Ll_transcript_16738

• Blastp: NAD(P)H-quinone oxidoreductase subunit M, chloroplastic from Vitis with 73.68% of identity
• Blastx: NAD(P)H-quinone oxidoreductase subunit M, chloroplastic from Vitis with 73.68% of identity
• Eggnog: electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon- concentration (By similarity)(ENOG4111NC5)
• Kegg: Link to kegg annotations (100264425)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415947.1)
• Pfam: Cyanobacterial and plastid NDH-1 subunit M (PF10664.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;