| Transcript | Ll_transcript_17487 |
|---|---|
| CDS coordinates | 2-307 (+) |
| Peptide sequence | FNVILVFLSRTFNLSLLKRKMRRVCNLELALFPSYNSNHHNNNINNPIMEASSGSPKIEQVHYHDQQQRQQKEQQNTLTIFYDGKICVSDVTELQVYMFFL* |
| ORF Type | 5prime_partial |
| Blastp | Protein TIFY 5A from Arabidopsis with 37.97% of identity |
|---|---|
| Blastx | - |
| Eggnog | TIFY 5A-like(ENOG410Z61E) |
| Kegg | Link to kegg annotations (AT1G30135) |
| CantataDB | Link to cantataDB annotations (CNT0000670) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019418305.1) |
| Pfam | tify domain (PF06200.13) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer