Protein coding transcript 183504

• Transcript: Ll_transcript_18989
• CDS coordinates: 927-1454 (+)
• Peptide sequence: MSVLELLAGENYRFGYKAAGDALELEKLCEEYGMEAYIIKSVMDKSHSAANLGSSTNSKEKGQVSSTRVREALAVGDMRYVLELLGRPHRLILMGTDQERFSVGQYKVSAPKSCLLNLAPKEGLYEKCSLILGQDNVQQCRVVIDTKFVYVETESDIFAAQNLQFLHIEFGDSST*
• ORF Type: complete

Annotations of Ll_transcript_18989

• Blastp: FAD synthetase 1, chloroplastic from Arabidopsis with 50.57% of identity
• Blastx: FAD synthetase 1, chloroplastic from Arabidopsis with 50.57% of identity
• Eggnog: riboflavin biosynthesis protein ribF(COG0196)
• Kegg: Link to kegg annotations (AT5G23330)
• CantataDB: Link to cantataDB annotations (CNT0001116)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441680.1)
• Pfam: FAD synthetase (PF06574.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;