Protein coding transcript 183527

• Transcript: Ll_transcript_17392
• CDS coordinates: 450-1976 (+)
• Peptide sequence: MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQQNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQPTPAPLPMPLAGWMSNPTTVAHPAVSGGGAIGLGAPSMPGNAMPGVLKHPRTPPTNPSADYPSGDSDHVSKRTRPMGLSDEVNLPVNVLSGTFPGHGHGHSQAFNAPDDLPKTVMRTLNQGSSPMSMDFHPVQQTLLLVGTNVGDIALWEVGTRERLVLRNFKVWELGACSMPFQAALVKDPGVSVNRVIWSPDGALFGVAYSRHIVQIYSYHGADEVRQHLEIDAHVGGVNDLAFSHPNKKLCVITCGDDKTIKVMLSKHEFFFVRK*
• ORF Type: complete

Annotations of Ll_transcript_17392

• Blastp: Protein TOPLESS from Arabidopsis with 85.69% of identity
• Blastx: Protein TOPLESS from Arabidopsis with 82.66% of identity
• Eggnog: Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein- mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for(ENOG410XP3K)
• Kegg: Link to kegg annotations (AT1G15750)
• CantataDB: Link to cantataDB annotations (CNT0002420)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457960.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;