Protein coding transcript 183534

• Transcript: Ll_transcript_17719
• CDS coordinates: 332-865 (+)
• Peptide sequence: MRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPMDEDFVGPLGLDLFEKEQSNLLADLIDIPKKACDRRINEFVKRARSAKIHAYIISHLKKEMPAIMGKAKAQQRLIDNLDEEFGKVQREFHLSAGDFPSVENFKEVLSRYNIDKFEKLKPKMVQAVDDMLGYEIPELLKKFRNPYN*
• ORF Type: complete

Annotations of Ll_transcript_17719

• Blastp: EH domain-containing protein 2 from Arabidopsis with 84.75% of identity
• Blastx: EH domain-containing protein 2 from Arabidopsis with 86.64% of identity
• Eggnog: EH-domain containing(ENOG410XYGB)
• Kegg: Link to kegg annotations (AT4G05520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418918.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;