Transcript | Ll_transcript_17709 |
---|---|
CDS coordinates | 964-1827 (+) |
Peptide sequence | MPFSGLTTFGGSFLSKFQCSQMPHPLLDEITFVDTPGVLSGEKQRTQRSYDFTGVVSWFAAKCDLILLLFDPHKLDISDEFKRVISSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVVRVYIGSFNDKPMDEDFVGPLGLDLFEKEQSNLLADLIDIPKKACDRRINEFVKRARSAKIHAYIISHLKKEMPAIMGKAKAQQRLIDNLDEEFGKVQREFHLSAGDFPSVENFKEVLSRYNIDKFEKLKPKMVQAVDDMLGYEIPELLKKFRNPYN* |
ORF Type | complete |
Blastp | EH domain-containing protein 2 from Arabidopsis with 86.41% of identity |
---|---|
Blastx | EH domain-containing protein 2 from Arabidopsis with 86.23% of identity |
Eggnog | EH-domain containing(ENOG410XYGB) |
Kegg | Link to kegg annotations (AT4G05520) |
CantataDB | Link to cantataDB annotations (CNT0002679) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418918.1) |
Pfam | Dynamin family (PF00350.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer