Protein coding transcript 183539

• Transcript: Ll_transcript_17712
• CDS coordinates: 3-494 (+)
• Peptide sequence: QKMKTHSKEESKTYQEWFDLADSDGDGRISGNEATDFFALSNLSRSQLKHLWALSDTKRQGFLGFNEFVTAMQLVALAQSGFDLNSDILKAQIDDQNIKPPVMEGLDALVAKTKRLTTISAQPEVYGNAQPHSPHPSSLIASKPAKKVSPNSFLISMPSFDKN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_17712

• Blastp: EH domain-containing protein 2 from Arabidopsis with 59.81% of identity
• Blastx: EH domain-containing protein 1 from Arabidopsis with 77.26% of identity
• Eggnog: EH-domain containing(ENOG410XYGB)
• Kegg: Link to kegg annotations (AT4G05520)
• CantataDB: Link to cantataDB annotations (CNT0002679)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463519.1)
• Pfam: Cytoskeletal-regulatory complex EF hand (PF12763.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;