Transcript | Ll_transcript_18180 |
---|---|
CDS coordinates | 258-920 (+) |
Peptide sequence | MESGAFVSVKHESKTTSTITIKGILSLLMASVNESNDANNRVISLGMGDPTIYTCFRTTTVADEAVADKIYSHKFNGYAPTAGLLQARNAIAEYLSCDLPYQLSSDDVFITCGCTQAIDVSIAMLAYPGANILLPRPGFPIYELSAAFRHVEVRHYDLLPEKGWEVDLDAIEALADQNTVALVIINPGNPCGNVYSYNHLEKVSSLLYGLKPDTFEKKCL* |
ORF Type | complete |
Blastp | Probable aminotransferase TAT2 from Arabidopsis with 71.22% of identity |
---|---|
Blastx | Probable aminotransferase TAT2 from Arabidopsis with 73.26% of identity |
Eggnog | aminotransferase(COG0436) |
Kegg | Link to kegg annotations (AT5G53970) |
CantataDB | Link to cantataDB annotations (CNT0001617) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451197.1) |
Pfam | Aminotransferase class I and II (PF00155.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer