Protein coding transcript 183567

• Transcript: Ll_transcript_18195
• CDS coordinates: 258-1145 (+)
• Peptide sequence: MESGAFVSVKHESKTTSTITIKGILSLLMASVNESNDANNRVISLGMGDPTIYTCFRTTTVADEAVADKIYSHKFNGYAPTAGLLQARNAIAEYLSCDLPYQLSSDDVFITCGCTQAIDVSIAMLAYPGANILLPRPGFPIYELSAAFRHVEVRHYDLLPEKGWEVDLDAIEALADQNTVALVIINPGNPCGNVYSYNHLEKIAEIAGRLGTIVIADEVYGHLAFGDKPFVPMGVFGSIVPVLTLGSLSKRWLVPGWRLGWFVINDPCGTYKKPKVSLPLSLFCLTCIMIYFYTF*
• ORF Type: complete

Annotations of Ll_transcript_18195

• Blastp: Probable aminotransferase TAT2 from Arabidopsis with 74.37% of identity
• Blastx: Probable aminotransferase TAT2 from Arabidopsis with 75.92% of identity
• Eggnog: aminotransferase(COG0436)
• Kegg: Link to kegg annotations (AT5G53970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451197.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;