Transcript | Ll_transcript_17342 |
---|---|
CDS coordinates | 219-641 (+) |
Peptide sequence | MASSLQKIEGDESVLLRVTHSNLKTFTADIRFSLQLTVEAVKDKLWKKCGTSVNSMHLELYDDARNKLADLSDNSKLLALYSPLDGFRLHVLDLDPSSVTSGGWLEDTSLVEKYKISDEAYNKLEGMFPTPSVLFKLSLF* |
ORF Type | complete |
Blastp | Tubulin-folding cofactor B from Arabidopsis with 69.92% of identity |
---|---|
Blastx | Tubulin-folding cofactor B from Arabidopsis with 69.92% of identity |
Eggnog | tubulin folding cofactor B(ENOG410YKGB) |
Kegg | Link to kegg annotations (AT3G10220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428994.1) |
Pfam | Ubiquitin-like domain (PF14560.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer