Protein coding transcript 18359

• Transcript: Ll_transcript_393467
• CDS coordinates: 129-677 (+)
• Peptide sequence: MSAIPKTEKNGIAVVDIDVDDGVDPTAVSSEVAPQVQNLDSRSFWKAGDYIAGSSSKPASFQGHLDHARVHPKFLHTNATSHKWAFGAIAELVDNAVDEIQNGATFVKVDRVDIMKDNSPALSFLDDGGGMSPESLRKCMSLGYSSKKSKTTIGQYGNGFKTSTMRLGADAIVFSRATCSGF*
• ORF Type: complete

Annotations of Ll_transcript_393467

• Blastp: Protein MICRORCHIDIA 2 from Arabidopsis with 64.06% of identity
• Blastx: Protein MICRORCHIDIA 1 from Arabidopsis with 69.4% of identity
• Eggnog: MORC family CW-type zinc finger(ENOG411033B)
• Kegg: Link to kegg annotations (AT4G36280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422114.1)
• Pfam: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF13589.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;