Protein coding transcript 1836

• Transcript: Ll_transcript_491631
• CDS coordinates: 3-317 (+)
• Peptide sequence: SLAEVTYAVGNNTIGYQITESVRQAKFRVRTKQENVSGVFLPQFESFQMEGGSDFQMTGLGKGGQQVAKCRETYTRAVETLVELASLQTAFVILDEVIKVVNRRV
• ORF Type: internal

Annotations of Ll_transcript_491631

• Blastp: V-type proton ATPase subunit D from Neurospora with 80% of identity
• Blastx: V-type proton ATPase subunit D from Neurospora with 80% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU08035)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014515702.1)
• Pfam: ATP synthase subunit D (PF01813.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;