Protein coding transcript 18361

• Transcript: Ll_transcript_393474
• CDS coordinates: 129-677 (+)
• Peptide sequence: MSAIPKTEKNGIAVVDIDVDDGVDPTAVSSEVAPQVQNLDSRSFWKAGDYIAGSSSKPASFQGHLDHARVHPKFLHTNATSHKWAFGAIAELVDNAVDEIQNGATFVKVDRVDIMKDNSPALSFLDDGGGMSPESLRKCMSLGYSSKKSKTTIGQYGNGFKTSTMRLGADAIVFSRATCSGF*
• ORF Type: complete

Annotations of Ll_transcript_393474

• Blastp: Protein MICRORCHIDIA 1 from Arabidopsis with 54.01% of identity
• Blastx: Protein MICRORCHIDIA 1 from Arabidopsis with 55.89% of identity
• Eggnog: MORC family CW-type zinc finger(ENOG411033B)
• Kegg: Link to kegg annotations (AT4G36290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422114.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;