Transcript | Ll_transcript_18819 |
---|---|
CDS coordinates | 2-466 (+) |
Peptide sequence | EHVSLSSPSSVVSQRKWVMASTSASAIPLCFPSSQKHPRKGKGTLHLHVVKSIQQNDTTPIPSKELPVTVSRRHCLTILPSTLALLTASATPILVPKANAADAMEKPVCRNCQGSGAVLCKLSMMNSIEQYSSKQRNEISIILKSHRNLFLEEA* |
ORF Type | 5prime_partial |
Blastp | Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic from Oryza sativa with 36.36% of identity |
---|---|
Blastx | Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic from Arabidopsis with 96.97% of identity |
Eggnog | NA(ENOG4111XYA) |
Kegg | Link to kegg annotations (4345779) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427516.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer