Protein coding transcript 183615

• Transcript: Ll_transcript_18821
• CDS coordinates: 790-1185 (+)
• Peptide sequence: MQELPVTVSRRHCLTILPSTLALLTASATPILVPKANAADAMEKPVCRNCQGSGAVLCDMCGGTGKWKALNRKRAKDVYEFTECPNCYGRGKLVCPVCLGTGLPNNKGLLRRPDAKKLLDKMYNGRLLPNS*
• ORF Type: complete

Annotations of Ll_transcript_18821

• Blastp: Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic from Oryza sativa with 75.57% of identity
• Blastx: Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic from Zea with 83.5% of identity
• Eggnog: NA(ENOG4111XYA)
• Kegg: Link to kegg annotations (4345779)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427516.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;