Protein coding transcript 183618

• Transcript: Ll_transcript_18824
• CDS coordinates: 1-402 (+)
• Peptide sequence: HQLILPFHLQFSSTFLSGKGKGTLHLHVVKSIQQNDTTPIPSKELPVTVSRRHCLTILPSTLALLTASATPILVPKANAADAMEKPVCRNCQGSGAVLCKLSMMNSIEQYSSKQRNEISIILKSHRNLFLEEA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_18824

• Blastp: Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic from Oryza sativa with 36.36% of identity
• Blastx: Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic from Arabidopsis with 96.97% of identity
• Eggnog: NA(ENOG4111XYA)
• Kegg: Link to kegg annotations (4345779)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427516.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;