Transcript | Ll_transcript_393480 |
---|---|
CDS coordinates | 129-677 (+) |
Peptide sequence | MSAIPKTEKNGIAVVDIDVDDGVDPTAVSSEVAPQVQNLDSRSFWKAGDYIAGSSSKPASFQGHLDHARVHPKFLHTNATSHKWAFGAIAELVDNAVDEIQNGATFVKVDRVDIMKDNSPALSFLDDGGGMSPESLRKCMSLGYSSKKSKTTIGQYGNGFKTSTMRLGADAIVFSRATCSGF* |
ORF Type | complete |
Blastp | Protein MICRORCHIDIA 2 from Arabidopsis with 64.06% of identity |
---|---|
Blastx | Protein MICRORCHIDIA 1 from Arabidopsis with 68.98% of identity |
Eggnog | MORC family CW-type zinc finger(ENOG411033B) |
Kegg | Link to kegg annotations (AT4G36280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422114.1) |
Pfam | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF13589.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer