Transcript | Ll_transcript_18861 |
---|---|
CDS coordinates | 462-767 (+) |
Peptide sequence | MPVPLAPYPTPPAPAANGAQSQLVCSGCRNLLLYPVVATSVCCSVCNVVTAVPPPGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLALEGIQLLRAS* |
ORF Type | complete |
Blastp | Protein LOL1 from Arabidopsis with 83.33% of identity |
---|---|
Blastx | Protein LOL1 from Arabidopsis with 89.74% of identity |
Eggnog | LSD1 zinc finger domain containing protein, expressed(ENOG410YHD1) |
Kegg | Link to kegg annotations (AT1G32540) |
CantataDB | Link to cantataDB annotations (CNT0000549) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016174851.1) |
Pfam | LSD1 zinc finger (PF06943.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer