Protein coding transcript 183640

• Transcript: Ll_transcript_18861
• CDS coordinates: 462-767 (+)
• Peptide sequence: MPVPLAPYPTPPAPAANGAQSQLVCSGCRNLLLYPVVATSVCCSVCNVVTAVPPPGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLALEGIQLLRAS*
• ORF Type: complete

Annotations of Ll_transcript_18861

• Blastp: Protein LOL1 from Arabidopsis with 83.33% of identity
• Blastx: Protein LOL1 from Arabidopsis with 89.74% of identity
• Eggnog: LSD1 zinc finger domain containing protein, expressed(ENOG410YHD1)
• Kegg: Link to kegg annotations (AT1G32540)
• CantataDB: Link to cantataDB annotations (CNT0000549)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016174851.1)
• Pfam: LSD1 zinc finger (PF06943.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;