Protein coding transcript 183643

• Transcript: Ll_transcript_16927
• CDS coordinates: 1-327 (+)
• Peptide sequence: QRRTYDRLKLHLPKKFCQLPKLPFPQDFPEYPSKKQFIDYLETYARKFEINPLFNECVQCARYDETSGLWRVKSFSSTSRNEVEYICRWLVVATGENAECVRPDIEGLS
• ORF Type: internal

Annotations of Ll_transcript_16927

• Blastp: Probable indole-3-pyruvate monooxygenase YUCCA8 from Arabidopsis with 78.38% of identity
• Blastx: Probable indole-3-pyruvate monooxygenase YUCCA8 from Arabidopsis with 78.38% of identity
• Eggnog: Monooxygenase(COG2072)
• Kegg: Link to kegg annotations (AT4G28720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455315.1)
• Pfam: L-lysine 6-monooxygenase (NADPH-requiring) (PF13434.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;