Protein coding transcript 183645

• Transcript: Ll_transcript_16932
• CDS coordinates: 1441-1779 (+)
• Peptide sequence: MLKWLPLWLVDKLLLIFTWFILGNIEKYGIKRPSKGPLELKNTMGKTPVLDIGTLEKIRSGYINVVPGIKSFNDRDVELVNGEKLDIDAVVLATGYRSNVPSWLQVQNVSIT*
• ORF Type: complete

Annotations of Ll_transcript_16932

• Blastp: Probable indole-3-pyruvate monooxygenase YUCCA8 from Arabidopsis with 74.29% of identity
• Blastx: Probable indole-3-pyruvate monooxygenase YUCCA8 from Arabidopsis with 72.58% of identity
• Eggnog: Monooxygenase(COG2072)
• Kegg: Link to kegg annotations (AT4G28720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424966.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;