Protein coding transcript 183688

• Transcript: Ll_transcript_17772
• CDS coordinates: 1226-1615 (+)
• Peptide sequence: MTPDGIAEQIRNLGALGYCAPELAMAPKPVPSFKADVYALGVILMEILTRKSAGDIISGQLGAVDLTDWVRLCAQEGRVMNCIDRDIAGEEESFKGMYELFAISLRCVLLVNERPNIRQVYDDLCSILV*
• ORF Type: complete

Annotations of Ll_transcript_17772

• Blastp: Probable inactive receptor kinase At5g10020 from Arabidopsis with 72.44% of identity
• Blastx: Probable inactive receptor kinase At5g10020 from Arabidopsis with 71.35% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G10020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430241.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;