Protein coding transcript 183691

• Transcript: Ll_transcript_17776
• CDS coordinates: 1293-1682 (+)
• Peptide sequence: MTPAGIAEQILNLGALGYRAPELATASKPVPSFKADVYALGVILMEILTRKSAGDIISGQSGAVDLTDWVRLCEQEGRVMDCIDRDIAGGEESSNRMDELLAISLRCILPVNERPNIRQVFDDLCSISV*
• ORF Type: complete

Annotations of Ll_transcript_17776

• Blastp: Probable inactive receptor kinase At5g10020 from Arabidopsis with 76.56% of identity
• Blastx: Probable inactive receptor kinase At5g10020 from Arabidopsis with 75.52% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G10020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437252.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;