Protein coding transcript 1837

• Transcript: Ll_transcript_491566
• CDS coordinates: 78-614 (+)
• Peptide sequence: MTEDYFWGLTLKKNKEKEVWDPDMKIESNNDGTGIRGEHTLLVKQIVLGPEAKEGEVNVVEVEAMGYKSDVRFPIAVMKGGGAQAQSVLDLLFPDPPVTFHLVKGSGPVHLLGNHTVGTGELVGDDDEEEDLEDELDEEDLDDLEESPERNNIEEKKRKVAQANSNKNKGKKPKLEEK*
• ORF Type: complete

Annotations of Ll_transcript_491566

• Blastp: Nucleoplasmin-like protein from Sophophora with 42.61% of identity
• Blastx: Nucleoplasmin-like protein from Sophophora with 42.61% of identity
• Eggnog: Nucleoplasmin(ENOG41120AT)
• Kegg: Link to kegg annotations (Dmel_CG7917)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425778.1)
• Pfam: Nucleoplasmin/nucleophosmin domain (PF03066.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;