Protein coding transcript 183758

• Transcript: Ll_transcript_18314
• CDS coordinates: 559-876 (+)
• Peptide sequence: MKQEKRMKQYQEELKMKQMKSSDTPSLSVERMREAQARLQTPYLVLSGHVKPGQTSDPKSGFATVEKDLPGGLTPMLGDRKVEHFLGIKRKAEPSSSDAFKRPKS*
• ORF Type: complete

Annotations of Ll_transcript_18314

• Blastp: SART-1 family protein DOT2 from Arabidopsis with 84.76% of identity
• Blastx: SART-1 family protein DOT2 from Arabidopsis with 86.51% of identity
• Eggnog: Squamous cell carcinoma antigen recognized by T cells(ENOG410XSTT)
• Kegg: Link to kegg annotations (AT5G16780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449363.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;