Protein coding transcript 183784

• Transcript: Ll_transcript_18559
• CDS coordinates: 1486-2160 (+)
• Peptide sequence: MLHFCHEAAIEFADRFNTALVCHRWNYLACHPRLWLRVDRSVRDLSEPGVFPNIETAISASRPGDTILIAAGGSHHVSNIQIEKPLCLIGAGEVPDDTTLICSRGSDSALELLSTCKLANLTVKAELGCCLLHRRGRLTVDGCILQCETNPLDYLSCPIVSTSSRNEAIPSSIKSNKGDGVFVSQTRIEGGAKAVLTSGDLVLQRVRVIYARASLLFWFDVEQL*
• ORF Type: complete

Annotations of Ll_transcript_18559

• Blastp: F-box protein SKIP5 from Arabidopsis with 72.85% of identity
• Blastx: F-box protein SKIP5 from Arabidopsis with 73.85% of identity
• Eggnog: F-box protein(ENOG4111FZA)
• Kegg: Link to kegg annotations (AT3G54480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427758.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;