| Transcript | Ll_transcript_17834 |
|---|---|
| CDS coordinates | 3-323 (-) |
| Peptide sequence | ECLGFGDFMDLDSIECVSFSDGMDEDEIHLLHHNSEFSSTKPRNGSTNHNNSLVPTVIAPATSVHELLECPVCTNSMYPPIHQCHNGHTLCSTCKTRVHNRCPTCRQ |
| ORF Type | internal |
| Blastp | E3 ubiquitin-protein ligase SINAT4 from Arabidopsis with 63.81% of identity |
|---|---|
| Blastx | E3 ubiquitin-protein ligase SINAT4 from Arabidopsis with 63.81% of identity |
| Eggnog | e3 ubiquitin-protein ligase(ENOG410XVP0) |
| Kegg | Link to kegg annotations (AT4G27880) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417625.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer